Anti ARRB2 pAb (ATL-HPA065681)

Atlas Antibodies

Catalog No.:
ATL-HPA065681-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: arrestin, beta 2
Gene Name: ARRB2
Alternative Gene Name: ARR2, BARR2, DKFZp686L0365
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060216: 94%, ENSRNOG00000019308: 94%
Entrez Gene ID: 409
Uniprot ID: P32121
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DLFIATYQAFPPVPNPPRPPTRLQDRLLRKL
Gene Sequence DLFIATYQAFPPVPNPPRPPTRLQDRLLRKL
Gene ID - Mouse ENSMUSG00000060216
Gene ID - Rat ENSRNOG00000019308
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARRB2 pAb (ATL-HPA065681)
Datasheet Anti ARRB2 pAb (ATL-HPA065681) Datasheet (External Link)
Vendor Page Anti ARRB2 pAb (ATL-HPA065681) at Atlas Antibodies

Documents & Links for Anti ARRB2 pAb (ATL-HPA065681)
Datasheet Anti ARRB2 pAb (ATL-HPA065681) Datasheet (External Link)
Vendor Page Anti ARRB2 pAb (ATL-HPA065681)