Anti ARPP19 pAb (ATL-HPA056851)

Atlas Antibodies

Catalog No.:
ATL-HPA056851-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cAMP-regulated phosphoprotein, 19kDa
Gene Name: ARPP19
Alternative Gene Name: ARPP-16, ARPP-19, ARPP16, ENSAL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007656: 100%, ENSRNOG00000023086: 100%
Entrez Gene ID: 10776
Uniprot ID: P56211
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSAEVPEAASAEEQKEMEDKVTSPEKAEEAK
Gene Sequence MSAEVPEAASAEEQKEMEDKVTSPEKAEEAK
Gene ID - Mouse ENSMUSG00000007656
Gene ID - Rat ENSRNOG00000023086
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARPP19 pAb (ATL-HPA056851)
Datasheet Anti ARPP19 pAb (ATL-HPA056851) Datasheet (External Link)
Vendor Page Anti ARPP19 pAb (ATL-HPA056851) at Atlas Antibodies

Documents & Links for Anti ARPP19 pAb (ATL-HPA056851)
Datasheet Anti ARPP19 pAb (ATL-HPA056851) Datasheet (External Link)
Vendor Page Anti ARPP19 pAb (ATL-HPA056851)