Anti ARPIN pAb (ATL-HPA047173)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047173-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ARPIN
Alternative Gene Name: C15orf38, MGC61550
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039043: 91%, ENSRNOG00000014589: 92%
Entrez Gene ID: 348110
Uniprot ID: Q7Z6K5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FDAKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTPEALKGLVNKPELLALTESLTPDHTVAFWMPESEME |
Gene Sequence | FDAKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTPEALKGLVNKPELLALTESLTPDHTVAFWMPESEME |
Gene ID - Mouse | ENSMUSG00000039043 |
Gene ID - Rat | ENSRNOG00000014589 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ARPIN pAb (ATL-HPA047173) | |
Datasheet | Anti ARPIN pAb (ATL-HPA047173) Datasheet (External Link) |
Vendor Page | Anti ARPIN pAb (ATL-HPA047173) at Atlas Antibodies |
Documents & Links for Anti ARPIN pAb (ATL-HPA047173) | |
Datasheet | Anti ARPIN pAb (ATL-HPA047173) Datasheet (External Link) |
Vendor Page | Anti ARPIN pAb (ATL-HPA047173) |