Anti ARPIN pAb (ATL-HPA047173)

Atlas Antibodies

Catalog No.:
ATL-HPA047173-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: actin-related protein 2/3 complex inhibitor
Gene Name: ARPIN
Alternative Gene Name: C15orf38, MGC61550
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039043: 91%, ENSRNOG00000014589: 92%
Entrez Gene ID: 348110
Uniprot ID: Q7Z6K5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FDAKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTPEALKGLVNKPELLALTESLTPDHTVAFWMPESEME
Gene Sequence FDAKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTPEALKGLVNKPELLALTESLTPDHTVAFWMPESEME
Gene ID - Mouse ENSMUSG00000039043
Gene ID - Rat ENSRNOG00000014589
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARPIN pAb (ATL-HPA047173)
Datasheet Anti ARPIN pAb (ATL-HPA047173) Datasheet (External Link)
Vendor Page Anti ARPIN pAb (ATL-HPA047173) at Atlas Antibodies

Documents & Links for Anti ARPIN pAb (ATL-HPA047173)
Datasheet Anti ARPIN pAb (ATL-HPA047173) Datasheet (External Link)
Vendor Page Anti ARPIN pAb (ATL-HPA047173)