Anti ARPC5L pAb (ATL-HPA022013)

Atlas Antibodies

Catalog No.:
ATL-HPA022013-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: actin related protein 2/3 complex, subunit 5-like
Gene Name: ARPC5L
Alternative Gene Name: ARC16-2, MGC3038
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026755: 99%, ENSRNOG00000014317: 99%
Entrez Gene ID: 81873
Uniprot ID: Q9BPX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
Gene Sequence NFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
Gene ID - Mouse ENSMUSG00000026755
Gene ID - Rat ENSRNOG00000014317
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARPC5L pAb (ATL-HPA022013)
Datasheet Anti ARPC5L pAb (ATL-HPA022013) Datasheet (External Link)
Vendor Page Anti ARPC5L pAb (ATL-HPA022013) at Atlas Antibodies

Documents & Links for Anti ARPC5L pAb (ATL-HPA022013)
Datasheet Anti ARPC5L pAb (ATL-HPA022013) Datasheet (External Link)
Vendor Page Anti ARPC5L pAb (ATL-HPA022013)