Anti ARPC5L pAb (ATL-HPA022013)

Atlas Antibodies

Catalog No.: ATL-HPA022013-25

Protein Description: actin related protein 2/3 complex, subunit 5-like
Gene Name: ARPC5L
Alternative Gene Name: ARC16-2, MGC3038
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026755: 99%, ENSRNOG00000014317: 99%
Entrez Gene ID: 81873
Uniprot ID: Q9BPX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
• Gene Sequence: NFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
• Gene ID - Mouse: ENSMUSG00000026755
• Gene ID - Rat: ENSRNOG00000014317
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.