Anti ARPC3 pAb (ATL-HPA006550)

Atlas Antibodies

SKU:
ATL-HPA006550-25
  • Immunohistochemical staining of human lymph node shows moderate cytoplasmic and nuclear positivity in germinal center cells.
  • Western blot analysis in human cell line HL-60.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: actin related protein 2/3 complex, subunit 3, 21kDa
Gene Name: ARPC3
Alternative Gene Name: ARC21, p21-Arc
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029465: 97%, ENSRNOG00000008673: 97%
Entrez Gene ID: 10094
Uniprot ID: O15145
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen DPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSK
Gene Sequence DPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSK
Gene ID - Mouse ENSMUSG00000029465
Gene ID - Rat ENSRNOG00000008673
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARPC3 pAb (ATL-HPA006550)
Datasheet Anti ARPC3 pAb (ATL-HPA006550) Datasheet (External Link)
Vendor Page Anti ARPC3 pAb (ATL-HPA006550) at Atlas Antibodies

Documents & Links for Anti ARPC3 pAb (ATL-HPA006550)
Datasheet Anti ARPC3 pAb (ATL-HPA006550) Datasheet (External Link)
Vendor Page Anti ARPC3 pAb (ATL-HPA006550)



Citations for Anti ARPC3 pAb (ATL-HPA006550) – 2 Found
Kahr, Walter H A; Pluthero, Fred G; Elkadri, Abdul; Warner, Neil; Drobac, Marko; Chen, Chang Hua; Lo, Richard W; Li, Ling; Li, Ren; Li, Qi; Thoeni, Cornelia; Pan, Jie; Leung, Gabriella; Lara-Corrales, Irene; Murchie, Ryan; Cutz, Ernest; Laxer, Ronald M; Upton, Julia; Roifman, Chaim M; Yeung, Rae S M; Brumell, John H; Muise, Aleixo M. Loss of the Arp2/3 complex component ARPC1B causes platelet abnormalities and predisposes to inflammatory disease. Nature Communications. 2017;8( 28368018):14816.  PubMed
Li, Kunping; Li, Yuqing; Lyu, Yinfeng; Tan, Linyi; Zheng, Xinyi; Jiang, Haowen; Wen, Hui; Feng, Chenchen. Development of a Phagocytosis-Dependent Gene Signature to Predict Prognosis and Response to Checkpoint Inhibition in Clear-Cell Renal Cell Carcinoma. Frontiers In Immunology. 13( 35651604):853088.  PubMed