Anti ARPC3 pAb (ATL-HPA006550)
Atlas Antibodies
- SKU:
- ATL-HPA006550-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ARPC3
Alternative Gene Name: ARC21, p21-Arc
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029465: 97%, ENSRNOG00000008673: 97%
Entrez Gene ID: 10094
Uniprot ID: O15145
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSK |
Gene Sequence | DPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSK |
Gene ID - Mouse | ENSMUSG00000029465 |
Gene ID - Rat | ENSRNOG00000008673 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ARPC3 pAb (ATL-HPA006550) | |
Datasheet | Anti ARPC3 pAb (ATL-HPA006550) Datasheet (External Link) |
Vendor Page | Anti ARPC3 pAb (ATL-HPA006550) at Atlas Antibodies |
Documents & Links for Anti ARPC3 pAb (ATL-HPA006550) | |
Datasheet | Anti ARPC3 pAb (ATL-HPA006550) Datasheet (External Link) |
Vendor Page | Anti ARPC3 pAb (ATL-HPA006550) |
Citations for Anti ARPC3 pAb (ATL-HPA006550) – 2 Found |
Kahr, Walter H A; Pluthero, Fred G; Elkadri, Abdul; Warner, Neil; Drobac, Marko; Chen, Chang Hua; Lo, Richard W; Li, Ling; Li, Ren; Li, Qi; Thoeni, Cornelia; Pan, Jie; Leung, Gabriella; Lara-Corrales, Irene; Murchie, Ryan; Cutz, Ernest; Laxer, Ronald M; Upton, Julia; Roifman, Chaim M; Yeung, Rae S M; Brumell, John H; Muise, Aleixo M. Loss of the Arp2/3 complex component ARPC1B causes platelet abnormalities and predisposes to inflammatory disease. Nature Communications. 2017;8( 28368018):14816. PubMed |
Li, Kunping; Li, Yuqing; Lyu, Yinfeng; Tan, Linyi; Zheng, Xinyi; Jiang, Haowen; Wen, Hui; Feng, Chenchen. Development of a Phagocytosis-Dependent Gene Signature to Predict Prognosis and Response to Checkpoint Inhibition in Clear-Cell Renal Cell Carcinoma. Frontiers In Immunology. 13( 35651604):853088. PubMed |