Anti ARPC2 pAb (ATL-HPA052703)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052703-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ARPC2
Alternative Gene Name: ARC34, p34-Arc
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006304: 99%, ENSRNOG00000014289: 100%
Entrez Gene ID: 10109
Uniprot ID: O15144
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHY |
Gene Sequence | FDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHY |
Gene ID - Mouse | ENSMUSG00000006304 |
Gene ID - Rat | ENSRNOG00000014289 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ARPC2 pAb (ATL-HPA052703) | |
Datasheet | Anti ARPC2 pAb (ATL-HPA052703) Datasheet (External Link) |
Vendor Page | Anti ARPC2 pAb (ATL-HPA052703) at Atlas Antibodies |
Documents & Links for Anti ARPC2 pAb (ATL-HPA052703) | |
Datasheet | Anti ARPC2 pAb (ATL-HPA052703) Datasheet (External Link) |
Vendor Page | Anti ARPC2 pAb (ATL-HPA052703) |