Anti ARPC2 pAb (ATL-HPA052703)

Atlas Antibodies

Catalog No.:
ATL-HPA052703-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: actin related protein 2/3 complex subunit 2
Gene Name: ARPC2
Alternative Gene Name: ARC34, p34-Arc
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006304: 99%, ENSRNOG00000014289: 100%
Entrez Gene ID: 10109
Uniprot ID: O15144
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHY
Gene Sequence FDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHY
Gene ID - Mouse ENSMUSG00000006304
Gene ID - Rat ENSRNOG00000014289
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARPC2 pAb (ATL-HPA052703)
Datasheet Anti ARPC2 pAb (ATL-HPA052703) Datasheet (External Link)
Vendor Page Anti ARPC2 pAb (ATL-HPA052703) at Atlas Antibodies

Documents & Links for Anti ARPC2 pAb (ATL-HPA052703)
Datasheet Anti ARPC2 pAb (ATL-HPA052703) Datasheet (External Link)
Vendor Page Anti ARPC2 pAb (ATL-HPA052703)