Anti ARPC2 pAb (ATL-HPA008352)

Atlas Antibodies

Catalog No.:
ATL-HPA008352-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: actin related protein 2/3 complex, subunit 2, 34kDa
Gene Name: ARPC2
Alternative Gene Name: ARC34, p34-Arc
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006304: 99%, ENSRNOG00000014289: 99%
Entrez Gene ID: 10109
Uniprot ID: O15144
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen TVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
Gene Sequence TVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
Gene ID - Mouse ENSMUSG00000006304
Gene ID - Rat ENSRNOG00000014289
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARPC2 pAb (ATL-HPA008352)
Datasheet Anti ARPC2 pAb (ATL-HPA008352) Datasheet (External Link)
Vendor Page Anti ARPC2 pAb (ATL-HPA008352) at Atlas Antibodies

Documents & Links for Anti ARPC2 pAb (ATL-HPA008352)
Datasheet Anti ARPC2 pAb (ATL-HPA008352) Datasheet (External Link)
Vendor Page Anti ARPC2 pAb (ATL-HPA008352)
Citations for Anti ARPC2 pAb (ATL-HPA008352) – 4 Found
Pinto, Clyde Savio; Khandekar, Ameya; Bhavna, Rajasekaran; Kiesel, Petra; Pigino, Gaia; Sonawane, Mahendra. Microridges are apical epithelial projections formed of F-actin networks that organize the glycan layer. Scientific Reports. 2019;9(1):12191.  PubMed
Zhao, Miao; Spiess, Matthias; Johansson, Henrik J; Olofsson, Helene; Hu, Jianjiang; Lehtiö, Janne; Strömblad, Staffan. Identification of the PAK4 interactome reveals PAK4 phosphorylation of N-WASP and promotion of Arp2/3-dependent actin polymerization. Oncotarget. 2017;8(44):77061-77074.  PubMed
Engqvist, Hanna; Parris, Toshima Z; Kovács, Anikó; Rönnerman, Elisabeth Werner; Sundfeldt, Karin; Karlsson, Per; Helou, Khalil. Validation of Novel Prognostic Biomarkers for Early-Stage Clear-Cell, Endometrioid and Mucinous Ovarian Carcinomas Using Immunohistochemistry. Frontiers In Oncology. 10( 32133296):162.  PubMed
Xu, Ming-Shu; Yin, Lei-Miao; Cheng, Ai-Fang; Zhang, Ying-Jie; Zhang, Di; Tao, Miao-Miao; Deng, Yun-Yi; Ge, Lin-Bao; Shan, Chun-Lei. Cerebral Ischemia-Reperfusion Is Associated With Upregulation of Cofilin-1 in the Motor Cortex. Frontiers In Cell And Developmental Biology. 9( 33777942):634347.  PubMed