Anti ARPC1B pAb (ATL-HPA004832 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA004832-25

• 
• 

Protein Description: actin related protein 2/3 complex, subunit 1B, 41kDa
Gene Name: ARPC1B
Alternative Gene Name: ARC41, p40-ARC, p41-ARC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029622: 94%, ENSRNOG00000000991: 94%
Entrez Gene ID: 10095
Uniprot ID: O15143
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESA
• Gene Sequence: TVCLADADKKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESA
• Gene ID - Mouse: ENSMUSG00000029622
• Gene ID - Rat: ENSRNOG00000000991
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ARPC1B pAb (ATL-HPA004832 w/enhanced validation) – 8 Found

Moniz, Larissa S; Surinova, Silvia; Ghazaly, Essam; Velasco, Lorena Gonzalez; Haider, Syed; Rodríguez-Prados, Juan Carlos; Berenjeno, Inma M; Chelala, Claude; Vanhaesebroeck, Bart. Phosphoproteomic comparison of Pik3ca and Pten signalling identifies the nucleotidase NT5C as a novel AKT substrate. Scientific Reports. 2017;7( 28059163):39985. 

Kahr, Walter H A; Pluthero, Fred G; Elkadri, Abdul; Warner, Neil; Drobac, Marko; Chen, Chang Hua; Lo, Richard W; Li, Ling; Li, Ren; Li, Qi; Thoeni, Cornelia; Pan, Jie; Leung, Gabriella; Lara-Corrales, Irene; Murchie, Ryan; Cutz, Ernest; Laxer, Ronald M; Upton, Julia; Roifman, Chaim M; Yeung, Rae S M; Brumell, John H; Muise, Aleixo M. Loss of the Arp2/3 complex component ARPC1B causes platelet abnormalities and predisposes to inflammatory disease. Nature Communications. 2017;8( 28368018):14816. 

Leung, Gabriella; Zhou, Yuhuan; Ostrowski, Philip; Mylvaganam, Sivakami; Boroumand, Parastoo; Mulder, Daniel J; Guo, Conghui; Muise, Aleixo M; Freeman, Spencer A. ARPC1B binds WASP to control actin polymerization and curtail tonic signaling in B cells. Jci Insight. 2021;6(23) 

Wang, Dawei; Ye, Zuodong; Wei, Wenjie; Yu, Jingting; Huang, Lihong; Zhang, Hongmin; Yue, Jianbo. Capping protein regulates endosomal trafficking by controlling F-actin density around endocytic vesicles and recruiting RAB5 effectors. Elife. 2021;10( 34796874) 

Gamallat, Yaser; Zaaluk, Hend; Kish, Ealia Khosh; Abdelsalam, Ramy; Liosis, Konstantinos; Ghosh, Sunita; Bismar, Tarek A. ARPC1B Is Associated with Lethal Prostate Cancer and Its Inhibition Decreases Cell Invasion and Migration In Vitro. International Journal Of Molecular Sciences. 2022;23(3) 

Molinie, Nicolas; Rubtsova, Svetlana N; Fokin, Artem; Visweshwaran, Sai P; Rocques, Nathalie; Polesskaya, Anna; Schnitzler, Anne; Vacher, Sophie; Denisov, Evgeny V; Tashireva, Lubov A; Perelmuter, Vladimir M; Cherdyntseva, Nadezhda V; Bièche, Ivan; Gautreau, Alexis M. Cortical branched actin determines cell cycle progression. Cell Research. 2019;29(6):432-445. 

Randzavola, Lyra O; Strege, Katharina; Juzans, Marie; Asano, Yukako; Stinchcombe, Jane C; Gawden-Bone, Christian M; Seaman, Matthew Nj; Kuijpers, Taco W; Griffiths, Gillian M. Loss of ARPC1B impairs cytotoxic T lymphocyte maintenance and cytolytic activity. The Journal Of Clinical Investigation. 2019;129(12):5600-5614. 

Small, Annabelle G; Perveen, Khalida; Putty, Trishni; Patel, Nikita; Quinn, Patrick; Wechalekar, Mihir D; Hii, Charles S; Quach, Alex; Ferrante, Antonio. Neutrophils Require Activation to Express Functional Cell-Surface Complement Receptor Immunoglobulin. Frontiers In Immunology. 13( 35317169):840510.