Anti ARNTL2 pAb (ATL-HPA065355)

Atlas Antibodies

Catalog No.:
ATL-HPA065355-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: aryl hydrocarbon receptor nuclear translocator-like 2
Gene Name: ARNTL2
Alternative Gene Name: bHLHe6, BMAL2, CLIF, MOP9, PASD9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040187: 75%, ENSRNOG00000001830: 65%
Entrez Gene ID: 56938
Uniprot ID: Q8WYA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IVSVNTLVLGHSEPGEASFLPCSSQSSEESSRQSCMSVPGMSTGTVLGAGSIGTDIANEILD
Gene Sequence IVSVNTLVLGHSEPGEASFLPCSSQSSEESSRQSCMSVPGMSTGTVLGAGSIGTDIANEILD
Gene ID - Mouse ENSMUSG00000040187
Gene ID - Rat ENSRNOG00000001830
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARNTL2 pAb (ATL-HPA065355)
Datasheet Anti ARNTL2 pAb (ATL-HPA065355) Datasheet (External Link)
Vendor Page Anti ARNTL2 pAb (ATL-HPA065355) at Atlas Antibodies

Documents & Links for Anti ARNTL2 pAb (ATL-HPA065355)
Datasheet Anti ARNTL2 pAb (ATL-HPA065355) Datasheet (External Link)
Vendor Page Anti ARNTL2 pAb (ATL-HPA065355)