Anti ARNTL2 pAb (ATL-HPA065355)

Atlas Antibodies

SKU: ATL-HPA065355-25

• 
• 

Protein Description: aryl hydrocarbon receptor nuclear translocator-like 2
Gene Name: ARNTL2
Alternative Gene Name: bHLHe6, BMAL2, CLIF, MOP9, PASD9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040187: 75%, ENSRNOG00000001830: 65%
Entrez Gene ID: 56938
Uniprot ID: Q8WYA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IVSVNTLVLGHSEPGEASFLPCSSQSSEESSRQSCMSVPGMSTGTVLGAGSIGTDIANEILD
• Gene Sequence: IVSVNTLVLGHSEPGEASFLPCSSQSSEESSRQSCMSVPGMSTGTVLGAGSIGTDIANEILD
• Gene ID - Mouse: ENSMUSG00000040187
• Gene ID - Rat: ENSRNOG00000001830
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.