Anti ARNTL2 pAb (ATL-HPA065355)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065355-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ARNTL2
Alternative Gene Name: bHLHe6, BMAL2, CLIF, MOP9, PASD9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040187: 75%, ENSRNOG00000001830: 65%
Entrez Gene ID: 56938
Uniprot ID: Q8WYA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IVSVNTLVLGHSEPGEASFLPCSSQSSEESSRQSCMSVPGMSTGTVLGAGSIGTDIANEILD |
| Gene Sequence | IVSVNTLVLGHSEPGEASFLPCSSQSSEESSRQSCMSVPGMSTGTVLGAGSIGTDIANEILD |
| Gene ID - Mouse | ENSMUSG00000040187 |
| Gene ID - Rat | ENSRNOG00000001830 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARNTL2 pAb (ATL-HPA065355) | |
| Datasheet | Anti ARNTL2 pAb (ATL-HPA065355) Datasheet (External Link) |
| Vendor Page | Anti ARNTL2 pAb (ATL-HPA065355) at Atlas Antibodies |
| Documents & Links for Anti ARNTL2 pAb (ATL-HPA065355) | |
| Datasheet | Anti ARNTL2 pAb (ATL-HPA065355) Datasheet (External Link) |
| Vendor Page | Anti ARNTL2 pAb (ATL-HPA065355) |