Anti ARNTL pAb (ATL-HPA050938)

Atlas Antibodies

Catalog No.:
ATL-HPA050938-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: aryl hydrocarbon receptor nuclear translocator-like
Gene Name: ARNTL
Alternative Gene Name: bHLHe5, BMAL1, JAP3, MOP3, PASD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055116: 96%, ENSRNOG00000014448: 96%
Entrez Gene ID: 406
Uniprot ID: O00327
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDE
Gene Sequence SSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDE
Gene ID - Mouse ENSMUSG00000055116
Gene ID - Rat ENSRNOG00000014448
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARNTL pAb (ATL-HPA050938)
Datasheet Anti ARNTL pAb (ATL-HPA050938) Datasheet (External Link)
Vendor Page Anti ARNTL pAb (ATL-HPA050938) at Atlas Antibodies

Documents & Links for Anti ARNTL pAb (ATL-HPA050938)
Datasheet Anti ARNTL pAb (ATL-HPA050938) Datasheet (External Link)
Vendor Page Anti ARNTL pAb (ATL-HPA050938)