Anti ARMCX6 pAb (ATL-HPA048125)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048125-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ARMCX6
Alternative Gene Name: FLJ20811, GASP10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050394: 65%, ENSRNOG00000037707: 66%
Entrez Gene ID: 54470
Uniprot ID: Q7L4S7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LKFPLISEGSGCAKVQVLKPLMGLSEKPVLAGELVGAQMLFSFMSLFIRNGNREILLETPAP |
Gene Sequence | LKFPLISEGSGCAKVQVLKPLMGLSEKPVLAGELVGAQMLFSFMSLFIRNGNREILLETPAP |
Gene ID - Mouse | ENSMUSG00000050394 |
Gene ID - Rat | ENSRNOG00000037707 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ARMCX6 pAb (ATL-HPA048125) | |
Datasheet | Anti ARMCX6 pAb (ATL-HPA048125) Datasheet (External Link) |
Vendor Page | Anti ARMCX6 pAb (ATL-HPA048125) at Atlas Antibodies |
Documents & Links for Anti ARMCX6 pAb (ATL-HPA048125) | |
Datasheet | Anti ARMCX6 pAb (ATL-HPA048125) Datasheet (External Link) |
Vendor Page | Anti ARMCX6 pAb (ATL-HPA048125) |