Anti ARMCX6 pAb (ATL-HPA043030)

Atlas Antibodies

Catalog No.:
ATL-HPA043030-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: armadillo repeat containing, X-linked 6
Gene Name: ARMCX6
Alternative Gene Name: FLJ20811, GASP10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050394: 57%, ENSRNOG00000037707: 55%
Entrez Gene ID: 54470
Uniprot ID: Q7L4S7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SKCLFIQGKLLFAEPKDAGFPFSQDINSHLASLSMARNTSPTPDPTVREALCAPDNLNASIESQGQIKMYINEVCRETVSRCC
Gene Sequence SKCLFIQGKLLFAEPKDAGFPFSQDINSHLASLSMARNTSPTPDPTVREALCAPDNLNASIESQGQIKMYINEVCRETVSRCC
Gene ID - Mouse ENSMUSG00000050394
Gene ID - Rat ENSRNOG00000037707
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARMCX6 pAb (ATL-HPA043030)
Datasheet Anti ARMCX6 pAb (ATL-HPA043030) Datasheet (External Link)
Vendor Page Anti ARMCX6 pAb (ATL-HPA043030) at Atlas Antibodies

Documents & Links for Anti ARMCX6 pAb (ATL-HPA043030)
Datasheet Anti ARMCX6 pAb (ATL-HPA043030) Datasheet (External Link)
Vendor Page Anti ARMCX6 pAb (ATL-HPA043030)