Anti ARMCX3 pAb (ATL-HPA001530)

Atlas Antibodies

SKU:
ATL-HPA001530-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: armadillo repeat containing, X-linked 3
Gene Name: ARMCX3
Alternative Gene Name: ALEX3, GASP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049047: 100%, ENSRNOG00000025730: 99%
Entrez Gene ID: 51566
Uniprot ID: Q9UH62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTR
Gene Sequence MAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTR
Gene ID - Mouse ENSMUSG00000049047
Gene ID - Rat ENSRNOG00000025730
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARMCX3 pAb (ATL-HPA001530)
Datasheet Anti ARMCX3 pAb (ATL-HPA001530) Datasheet (External Link)
Vendor Page Anti ARMCX3 pAb (ATL-HPA001530) at Atlas Antibodies

Documents & Links for Anti ARMCX3 pAb (ATL-HPA001530)
Datasheet Anti ARMCX3 pAb (ATL-HPA001530) Datasheet (External Link)
Vendor Page Anti ARMCX3 pAb (ATL-HPA001530)