Anti ARMCX3 pAb (ATL-HPA000967)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000967-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ARMCX3
Alternative Gene Name: ALEX3, GASP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049047: 91%, ENSRNOG00000025730: 89%
Entrez Gene ID: 51566
Uniprot ID: Q9UH62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHM |
Gene Sequence | SAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHM |
Gene ID - Mouse | ENSMUSG00000049047 |
Gene ID - Rat | ENSRNOG00000025730 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ARMCX3 pAb (ATL-HPA000967) | |
Datasheet | Anti ARMCX3 pAb (ATL-HPA000967) Datasheet (External Link) |
Vendor Page | Anti ARMCX3 pAb (ATL-HPA000967) at Atlas Antibodies |
Documents & Links for Anti ARMCX3 pAb (ATL-HPA000967) | |
Datasheet | Anti ARMCX3 pAb (ATL-HPA000967) Datasheet (External Link) |
Vendor Page | Anti ARMCX3 pAb (ATL-HPA000967) |
Citations for Anti ARMCX3 pAb (ATL-HPA000967) – 1 Found |
Mou, Zhongming; Tapper, Andrew R; Gardner, Paul D. The armadillo repeat-containing protein, ARMCX3, physically and functionally interacts with the developmental regulatory factor Sox10. The Journal Of Biological Chemistry. 2009;284(20):13629-13640. PubMed |