Anti ARMCX3 pAb (ATL-HPA000967)

Atlas Antibodies

Catalog No.:
ATL-HPA000967-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: armadillo repeat containing, X-linked 3
Gene Name: ARMCX3
Alternative Gene Name: ALEX3, GASP6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049047: 91%, ENSRNOG00000025730: 89%
Entrez Gene ID: 51566
Uniprot ID: Q9UH62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHM
Gene Sequence SAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHM
Gene ID - Mouse ENSMUSG00000049047
Gene ID - Rat ENSRNOG00000025730
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARMCX3 pAb (ATL-HPA000967)
Datasheet Anti ARMCX3 pAb (ATL-HPA000967) Datasheet (External Link)
Vendor Page Anti ARMCX3 pAb (ATL-HPA000967) at Atlas Antibodies

Documents & Links for Anti ARMCX3 pAb (ATL-HPA000967)
Datasheet Anti ARMCX3 pAb (ATL-HPA000967) Datasheet (External Link)
Vendor Page Anti ARMCX3 pAb (ATL-HPA000967)
Citations for Anti ARMCX3 pAb (ATL-HPA000967) – 1 Found
Mou, Zhongming; Tapper, Andrew R; Gardner, Paul D. The armadillo repeat-containing protein, ARMCX3, physically and functionally interacts with the developmental regulatory factor Sox10. The Journal Of Biological Chemistry. 2009;284(20):13629-13640.  PubMed