Anti ARMCX2 pAb (ATL-HPA005761 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA005761-25
  • Immunohistochemistry analysis in human epididymis and colon tissues using Anti-ARMCX2 antibody. Corresponding ARMCX2 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line RH-30 shows localization to mitochondria.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: armadillo repeat containing, X-linked 2
Gene Name: ARMCX2
Alternative Gene Name: ALEX2, GASP9, KIAA0512
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033436: 59%, ENSRNOG00000025705: 55%
Entrez Gene ID: 9823
Uniprot ID: Q7L311
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RDQTKKRMAKPKNRAVAGTGARARAGLRAGFTIDLGSGFSPPTPVRAEAEDRAQDEASALDTVGAEAVAPAASSAEAQSGAGSQAQEADGAGVGPKAESVVGAAMASAIAPPPGVTEALGAAEAPAMAGAPKVAEAPREAETSRA
Gene Sequence RDQTKKRMAKPKNRAVAGTGARARAGLRAGFTIDLGSGFSPPTPVRAEAEDRAQDEASALDTVGAEAVAPAASSAEAQSGAGSQAQEADGAGVGPKAESVVGAAMASAIAPPPGVTEALGAAEAPAMAGAPKVAEAPREAETSRA
Gene ID - Mouse ENSMUSG00000033436
Gene ID - Rat ENSRNOG00000025705
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ARMCX2 pAb (ATL-HPA005761 w/enhanced validation)
Datasheet Anti ARMCX2 pAb (ATL-HPA005761 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARMCX2 pAb (ATL-HPA005761 w/enhanced validation)