Anti ARMCX1 pAb (ATL-HPA005685)

Atlas Antibodies

SKU:
ATL-HPA005685-25
  • Immunohistochemical staining of human heart muscle shows moderate granular cytoplasmic positivity in cardiomyocytes.
  • Immunofluorescent staining of human cell line RH-30 shows localization to nucleus & mitochondria.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: armadillo repeat containing, X-linked 1
Gene Name: ARMCX1
Alternative Gene Name: ALEX1, GASP7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033460: 57%, ENSRNOG00000046862: 57%
Entrez Gene ID: 51309
Uniprot ID: Q9P291
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEESTDTSEIGVETVKGAKTNAGAGSGAKLQGDSEVKPEVSLGLEDCPGVKEKAHSGSHSGGGLEAKAKALFNTLKEQASAKAGKGARVGTISGNRTLAPSLPCP
Gene Sequence DEESTDTSEIGVETVKGAKTNAGAGSGAKLQGDSEVKPEVSLGLEDCPGVKEKAHSGSHSGGGLEAKAKALFNTLKEQASAKAGKGARVGTISGNRTLAPSLPCP
Gene ID - Mouse ENSMUSG00000033460
Gene ID - Rat ENSRNOG00000046862
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARMCX1 pAb (ATL-HPA005685)
Datasheet Anti ARMCX1 pAb (ATL-HPA005685) Datasheet (External Link)
Vendor Page Anti ARMCX1 pAb (ATL-HPA005685) at Atlas Antibodies

Documents & Links for Anti ARMCX1 pAb (ATL-HPA005685)
Datasheet Anti ARMCX1 pAb (ATL-HPA005685) Datasheet (External Link)
Vendor Page Anti ARMCX1 pAb (ATL-HPA005685)