Anti ARMCX1 pAb (ATL-HPA005685)
Atlas Antibodies
- Catalog No.:
- ATL-HPA005685-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ARMCX1
Alternative Gene Name: ALEX1, GASP7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033460: 57%, ENSRNOG00000046862: 57%
Entrez Gene ID: 51309
Uniprot ID: Q9P291
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DEESTDTSEIGVETVKGAKTNAGAGSGAKLQGDSEVKPEVSLGLEDCPGVKEKAHSGSHSGGGLEAKAKALFNTLKEQASAKAGKGARVGTISGNRTLAPSLPCP |
| Gene Sequence | DEESTDTSEIGVETVKGAKTNAGAGSGAKLQGDSEVKPEVSLGLEDCPGVKEKAHSGSHSGGGLEAKAKALFNTLKEQASAKAGKGARVGTISGNRTLAPSLPCP |
| Gene ID - Mouse | ENSMUSG00000033460 |
| Gene ID - Rat | ENSRNOG00000046862 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARMCX1 pAb (ATL-HPA005685) | |
| Datasheet | Anti ARMCX1 pAb (ATL-HPA005685) Datasheet (External Link) |
| Vendor Page | Anti ARMCX1 pAb (ATL-HPA005685) at Atlas Antibodies |
| Documents & Links for Anti ARMCX1 pAb (ATL-HPA005685) | |
| Datasheet | Anti ARMCX1 pAb (ATL-HPA005685) Datasheet (External Link) |
| Vendor Page | Anti ARMCX1 pAb (ATL-HPA005685) |