Anti ARMC8 pAb (ATL-HPA036996)

Atlas Antibodies

SKU: ATL-HPA036996-25

• 
• 

Protein Description: armadillo repeat containing 8
Gene Name: ARMC8
Alternative Gene Name: DKFZP434A043, GID5, HSPC056, VID28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032468: 99%, ENSRNOG00000014521: 99%
Entrez Gene ID: 25852
Uniprot ID: Q8IUR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AVWKPLMKVLQNAPDEILVVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRVNGIWALMNMAFQAEQKIKADILRSLSTEQLFRLLSDSDL
• Gene Sequence: AVWKPLMKVLQNAPDEILVVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRVNGIWALMNMAFQAEQKIKADILRSLSTEQLFRLLSDSDL
• Gene ID - Mouse: ENSMUSG00000032468
• Gene ID - Rat: ENSRNOG00000014521
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.