Anti ARMC7 pAb (ATL-HPA024229)

Atlas Antibodies

Catalog No.:
ATL-HPA024229-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: armadillo repeat containing 7
Gene Name: ARMC7
Alternative Gene Name: FLJ22160
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057219: 90%, ENSRNOG00000042691: 92%
Entrez Gene ID: 79637
Uniprot ID: Q9H6L4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLDLFLDSLSEENETLVEFAIGGLCNLCPDRANKEHILHAGG
Gene Sequence MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLDLFLDSLSEENETLVEFAIGGLCNLCPDRANKEHILHAGG
Gene ID - Mouse ENSMUSG00000057219
Gene ID - Rat ENSRNOG00000042691
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARMC7 pAb (ATL-HPA024229)
Datasheet Anti ARMC7 pAb (ATL-HPA024229) Datasheet (External Link)
Vendor Page Anti ARMC7 pAb (ATL-HPA024229) at Atlas Antibodies

Documents & Links for Anti ARMC7 pAb (ATL-HPA024229)
Datasheet Anti ARMC7 pAb (ATL-HPA024229) Datasheet (External Link)
Vendor Page Anti ARMC7 pAb (ATL-HPA024229)