Anti ARMC7 pAb (ATL-HPA024229)

Atlas Antibodies

SKU: ATL-HPA024229-25

• 
• 
• 

Protein Description: armadillo repeat containing 7
Gene Name: ARMC7
Alternative Gene Name: FLJ22160
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057219: 90%, ENSRNOG00000042691: 92%
Entrez Gene ID: 79637
Uniprot ID: Q9H6L4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLDLFLDSLSEENETLVEFAIGGLCNLCPDRANKEHILHAGG
• Gene Sequence: MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLDLFLDSLSEENETLVEFAIGGLCNLCPDRANKEHILHAGG
• Gene ID - Mouse: ENSMUSG00000057219
• Gene ID - Rat: ENSRNOG00000042691
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.