Anti ARMC6 pAb (ATL-HPA041420)

Atlas Antibodies

SKU:
ATL-HPA041420-25
  • Immunohistochemical staining of human oral mucosa shows strong cytoplasmic positivity in squamous epithelial cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: armadillo repeat containing 6
Gene Name: ARMC6
Alternative Gene Name: MGC19595
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002343: 73%, ENSRNOG00000020280: 72%
Entrez Gene ID: 93436
Uniprot ID: Q6NXE6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSNIVKTAPKVSADGSQEPTHDILQMLSDLQESVASSRPQEVSAYLTRFCDQCKQDKACRFLAAQKGAYPIIFTAWKLATAGDQGLLLQSLNALSVL
Gene Sequence LSNIVKTAPKVSADGSQEPTHDILQMLSDLQESVASSRPQEVSAYLTRFCDQCKQDKACRFLAAQKGAYPIIFTAWKLATAGDQGLLLQSLNALSVL
Gene ID - Mouse ENSMUSG00000002343
Gene ID - Rat ENSRNOG00000020280
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARMC6 pAb (ATL-HPA041420)
Datasheet Anti ARMC6 pAb (ATL-HPA041420) Datasheet (External Link)
Vendor Page Anti ARMC6 pAb (ATL-HPA041420) at Atlas Antibodies

Documents & Links for Anti ARMC6 pAb (ATL-HPA041420)
Datasheet Anti ARMC6 pAb (ATL-HPA041420) Datasheet (External Link)
Vendor Page Anti ARMC6 pAb (ATL-HPA041420)