Anti ARMC4 pAb (ATL-HPA037829 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037829-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ARMC4
Alternative Gene Name: CILD23, DKFZP434P1735, FLJ10376, FLJ10817
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061802: 44%, ENSRNOG00000018905: 47%
Entrez Gene ID: 55130
Uniprot ID: Q5T2S8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FSEDQQKEKDQLGKAPKKEEAAALRKDISGSDKRSLEKNQINFWRNQMTKRWEPSLNWKTTVNYKGKGSAKEIQEDKHTGKLEKPRPSVSHG |
| Gene Sequence | FSEDQQKEKDQLGKAPKKEEAAALRKDISGSDKRSLEKNQINFWRNQMTKRWEPSLNWKTTVNYKGKGSAKEIQEDKHTGKLEKPRPSVSHG |
| Gene ID - Mouse | ENSMUSG00000061802 |
| Gene ID - Rat | ENSRNOG00000018905 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARMC4 pAb (ATL-HPA037829 w/enhanced validation) | |
| Datasheet | Anti ARMC4 pAb (ATL-HPA037829 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ARMC4 pAb (ATL-HPA037829 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ARMC4 pAb (ATL-HPA037829 w/enhanced validation) | |
| Datasheet | Anti ARMC4 pAb (ATL-HPA037829 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ARMC4 pAb (ATL-HPA037829 w/enhanced validation) |
| Citations for Anti ARMC4 pAb (ATL-HPA037829 w/enhanced validation) – 7 Found |
| Wallmeier, Julia; Shiratori, Hidetaka; Dougherty, Gerard W; Edelbusch, Christine; Hjeij, Rim; Loges, Niki T; Menchen, Tabea; Olbrich, Heike; Pennekamp, Petra; Raidt, Johanna; Werner, Claudius; Minegishi, Katsura; Shinohara, Kyosuke; Asai, Yasuko; Takaoka, Katsuyoshi; Lee, Chanjae; Griese, Matthias; Memari, Yasin; Durbin, Richard; Kolb-Kokocinski, Anja; Sauer, Sascha; Wallingford, John B; Hamada, Hiroshi; Omran, Heymut. TTC25 Deficiency Results in Defects of the Outer Dynein Arm Docking Machinery and Primary Ciliary Dyskinesia with Left-Right Body Asymmetry Randomization. American Journal Of Human Genetics. 2016;99(2):460-9. PubMed |
| Gao, Yang; Xu, Chuan; Tan, Qing; Shen, Qunshan; Wu, Huan; Lv, Mingrong; Li, Kuokuo; Tang, Dongdong; Song, Bing; Xu, Yuping; Zhou, Ping; Wei, Zhaolian; Tao, Fangbiao; Cao, Yunxia; He, Xiaojin. Case Report: Novel Biallelic Mutations in ARMC4 Cause Primary Ciliary Dyskinesia and Male Infertility in a Chinese Family. Frontiers In Genetics. 12( 34394199):715339. PubMed |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
| Hjeij, Rim; Lindstrand, Anna; Francis, Richard; Zariwala, Maimoona A; Liu, Xiaoqin; Li, You; Damerla, Rama; Dougherty, Gerard W; Abouhamed, Marouan; Olbrich, Heike; Loges, Niki T; Pennekamp, Petra; Davis, Erica E; Carvalho, Claudia M B; Pehlivan, Davut; Werner, Claudius; Raidt, Johanna; Köhler, Gabriele; Häffner, Karsten; Reyes-Mugica, Miguel; Lupski, James R; Leigh, Margaret W; Rosenfeld, Margaret; Morgan, Lucy C; Knowles, Michael R; Lo, Cecilia W; Katsanis, Nicholas; Omran, Heymut. ARMC4 mutations cause primary ciliary dyskinesia with randomization of left/right body asymmetry. American Journal Of Human Genetics. 2013;93(2):357-67. PubMed |
| Onoufriadis, Alexandros; Shoemark, Amelia; Munye, Mustafa M; James, Chela T; Schmidts, Miriam; Patel, Mitali; Rosser, Elisabeth M; Bacchelli, Chiara; Beales, Philip L; Scambler, Peter J; Hart, Stephen L; Danke-Roelse, Jeannette E; Sloper, John J; Hull, Sarah; Hogg, Claire; Emes, Richard D; Pals, Gerard; Moore, Anthony T; Chung, Eddie M K; Mitchison, Hannah M. Combined exome and whole-genome sequencing identifies mutations in ARMC4 as a cause of primary ciliary dyskinesia with defects in the outer dynein arm. Journal Of Medical Genetics. 2014;51(1):61-7. PubMed |
| Hjeij, Rim; Onoufriadis, Alexandros; Watson, Christopher M; Slagle, Christopher E; Klena, Nikolai T; Dougherty, Gerard W; Kurkowiak, Małgorzata; Loges, Niki T; Diggle, Christine P; Morante, Nicholas F C; Gabriel, George C; Lemke, Kristi L; Li, You; Pennekamp, Petra; Menchen, Tabea; Konert, Franziska; Marthin, June Kehlet; Mans, Dorus A; Letteboer, Stef J F; Werner, Claudius; Burgoyne, Thomas; Westermann, Cordula; Rutman, Andrew; Carr, Ian M; O'Callaghan, Christopher; Moya, Eduardo; Chung, Eddie M K; Sheridan, Eamonn; Nielsen, Kim G; Roepman, Ronald; Bartscherer, Kerstin; Burdine, Rebecca D; Lo, Cecilia W; Omran, Heymut; Mitchison, Hannah M. CCDC151 mutations cause primary ciliary dyskinesia by disruption of the outer dynein arm docking complex formation. American Journal Of Human Genetics. 2014;95(3):257-74. PubMed |
| Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535) PubMed |