Anti ARMC3 pAb (ATL-HPA037823 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA037823-25
  • Immunohistochemistry analysis in human fallopian tube and liver tissues using Anti-ARMC3 antibody. Corresponding ARMC3 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: armadillo repeat containing 3
Gene Name: ARMC3
Alternative Gene Name: CT81, FLJ32827
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037683: 88%, ENSRNOG00000016716: 89%
Entrez Gene ID: 219681
Uniprot ID: Q5W041
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLRSKNDEVRKHASWAVMVCAGDELTANELCRLGALDILEEVNVSGTRKNKFSEAAYNKLLNNNLSLKYSQTGYLSSSNIINDGFYDYGR
Gene Sequence LLRSKNDEVRKHASWAVMVCAGDELTANELCRLGALDILEEVNVSGTRKNKFSEAAYNKLLNNNLSLKYSQTGYLSSSNIINDGFYDYGR
Gene ID - Mouse ENSMUSG00000037683
Gene ID - Rat ENSRNOG00000016716
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARMC3 pAb (ATL-HPA037823 w/enhanced validation)
Datasheet Anti ARMC3 pAb (ATL-HPA037823 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARMC3 pAb (ATL-HPA037823 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ARMC3 pAb (ATL-HPA037823 w/enhanced validation)
Datasheet Anti ARMC3 pAb (ATL-HPA037823 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARMC3 pAb (ATL-HPA037823 w/enhanced validation)