Anti ARMC2 pAb (ATL-HPA025809 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA025809-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: armadillo repeat containing 2
Gene Name: ARMC2
Alternative Gene Name: bA787I22.1, DKFZp434P0714
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071324: 65%, ENSRNOG00000026217: 70%
Entrez Gene ID: 84071
Uniprot ID: Q8NEN0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKADLQEEDAEIEVDEVFWNTRIVPILRELEKEENIETVCAACTQLHHALEEGNMLGNKFKGRSILLKTLCKLVDVGSDSLS
Gene Sequence PKADLQEEDAEIEVDEVFWNTRIVPILRELEKEENIETVCAACTQLHHALEEGNMLGNKFKGRSILLKTLCKLVDVGSDSLS
Gene ID - Mouse ENSMUSG00000071324
Gene ID - Rat ENSRNOG00000026217
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARMC2 pAb (ATL-HPA025809 w/enhanced validation)
Datasheet Anti ARMC2 pAb (ATL-HPA025809 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARMC2 pAb (ATL-HPA025809 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ARMC2 pAb (ATL-HPA025809 w/enhanced validation)
Datasheet Anti ARMC2 pAb (ATL-HPA025809 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARMC2 pAb (ATL-HPA025809 w/enhanced validation)