Anti ARMC2 pAb (ATL-HPA025809 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA025809-25

• 

Protein Description: armadillo repeat containing 2
Gene Name: ARMC2
Alternative Gene Name: bA787I22.1, DKFZp434P0714
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071324: 65%, ENSRNOG00000026217: 70%
Entrez Gene ID: 84071
Uniprot ID: Q8NEN0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PKADLQEEDAEIEVDEVFWNTRIVPILRELEKEENIETVCAACTQLHHALEEGNMLGNKFKGRSILLKTLCKLVDVGSDSLS
• Gene Sequence: PKADLQEEDAEIEVDEVFWNTRIVPILRELEKEENIETVCAACTQLHHALEEGNMLGNKFKGRSILLKTLCKLVDVGSDSLS
• Gene ID - Mouse: ENSMUSG00000071324
• Gene ID - Rat: ENSRNOG00000026217
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.