Anti ARMC2 pAb (ATL-HPA025809 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA025809-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ARMC2
Alternative Gene Name: bA787I22.1, DKFZp434P0714
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071324: 65%, ENSRNOG00000026217: 70%
Entrez Gene ID: 84071
Uniprot ID: Q8NEN0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PKADLQEEDAEIEVDEVFWNTRIVPILRELEKEENIETVCAACTQLHHALEEGNMLGNKFKGRSILLKTLCKLVDVGSDSLS |
| Gene Sequence | PKADLQEEDAEIEVDEVFWNTRIVPILRELEKEENIETVCAACTQLHHALEEGNMLGNKFKGRSILLKTLCKLVDVGSDSLS |
| Gene ID - Mouse | ENSMUSG00000071324 |
| Gene ID - Rat | ENSRNOG00000026217 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARMC2 pAb (ATL-HPA025809 w/enhanced validation) | |
| Datasheet | Anti ARMC2 pAb (ATL-HPA025809 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ARMC2 pAb (ATL-HPA025809 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ARMC2 pAb (ATL-HPA025809 w/enhanced validation) | |
| Datasheet | Anti ARMC2 pAb (ATL-HPA025809 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ARMC2 pAb (ATL-HPA025809 w/enhanced validation) |