Anti ARMC12 pAb (ATL-HPA075457 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA075457-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: armadillo repeat containing 12
Gene Name: ARMC12
Alternative Gene Name: C6orf81, FLJ25390
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024223: 78%, ENSRNOG00000000508: 77%
Entrez Gene ID: 221481
Uniprot ID: Q5T9G4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QYLGQLDIRKSVVSLATGAGAIYLLYKAIKAGIKCKPPLCSNSPICIARLAVERERHGRDSGELRRLLNSLECKQDEYA
Gene Sequence QYLGQLDIRKSVVSLATGAGAIYLLYKAIKAGIKCKPPLCSNSPICIARLAVERERHGRDSGELRRLLNSLECKQDEYA
Gene ID - Mouse ENSMUSG00000024223
Gene ID - Rat ENSRNOG00000000508
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARMC12 pAb (ATL-HPA075457 w/enhanced validation)
Datasheet Anti ARMC12 pAb (ATL-HPA075457 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARMC12 pAb (ATL-HPA075457 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ARMC12 pAb (ATL-HPA075457 w/enhanced validation)
Datasheet Anti ARMC12 pAb (ATL-HPA075457 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARMC12 pAb (ATL-HPA075457 w/enhanced validation)