Anti ARMC12 pAb (ATL-HPA075457 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA075457-25

Protein Description: armadillo repeat containing 12
Gene Name: ARMC12
Alternative Gene Name: C6orf81, FLJ25390
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024223: 78%, ENSRNOG00000000508: 77%
Entrez Gene ID: 221481
Uniprot ID: Q5T9G4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QYLGQLDIRKSVVSLATGAGAIYLLYKAIKAGIKCKPPLCSNSPICIARLAVERERHGRDSGELRRLLNSLECKQDEYA
• Gene Sequence: QYLGQLDIRKSVVSLATGAGAIYLLYKAIKAGIKCKPPLCSNSPICIARLAVERERHGRDSGELRRLLNSLECKQDEYA
• Gene ID - Mouse: ENSMUSG00000024223
• Gene ID - Rat: ENSRNOG00000000508
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.