Anti ARMC10 pAb (ATL-HPA011057 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA011057-25

• 
• 
• 

Protein Description: armadillo repeat containing 10
Gene Name: ARMC10
Alternative Gene Name: MGC3195, SVH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038525: 76%, ENSRNOG00000012785: 73%
Entrez Gene ID: 83787
Uniprot ID: Q8N2F6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKLLLNLSENPAMTEGLLRAQVDSSFLSLYDSHVAKEILLRVLTLFQNIKNCLKIEGHLAVQPTFTEGSLFFLLHGEECAQKIRALVDHHDAEVKEKVVTIIPKI
• Gene Sequence: LKLLLNLSENPAMTEGLLRAQVDSSFLSLYDSHVAKEILLRVLTLFQNIKNCLKIEGHLAVQPTFTEGSLFFLLHGEECAQKIRALVDHHDAEVKEKVVTIIPKI
• Gene ID - Mouse: ENSMUSG00000038525
• Gene ID - Rat: ENSRNOG00000012785
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.