Anti ARMC1 pAb (ATL-HPA026085 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA026085-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in distal tubules.
  • Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: armadillo repeat containing 1
Gene Name: ARMC1
Alternative Gene Name: Arcp, FLJ10511
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027599: 98%, ENSRNOG00000013253: 96%
Entrez Gene ID: 55156
Uniprot ID: Q9NVT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSTSTMSEEPDALSVVNQLRDLAADPLNRRAIVQDQGCLPGLILFMDHPNPPVVHSALLALRYLAECRANREKMKGELGMMLSLQNVIQKTTTPGETKLLASEIYDILQSSNMADGDSFNEMNSRRRKAQFFLGTTNKRA
Gene Sequence SSTSTMSEEPDALSVVNQLRDLAADPLNRRAIVQDQGCLPGLILFMDHPNPPVVHSALLALRYLAECRANREKMKGELGMMLSLQNVIQKTTTPGETKLLASEIYDILQSSNMADGDSFNEMNSRRRKAQFFLGTTNKRA
Gene ID - Mouse ENSMUSG00000027599
Gene ID - Rat ENSRNOG00000013253
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARMC1 pAb (ATL-HPA026085 w/enhanced validation)
Datasheet Anti ARMC1 pAb (ATL-HPA026085 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARMC1 pAb (ATL-HPA026085 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ARMC1 pAb (ATL-HPA026085 w/enhanced validation)
Datasheet Anti ARMC1 pAb (ATL-HPA026085 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARMC1 pAb (ATL-HPA026085 w/enhanced validation)