Anti ARL9 pAb (ATL-HPA072942 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA072942-25
  • Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-ARL9 antibody. Corresponding ARL9 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line PC-3 shows localization to nucleoli & mitochondria.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ADP-ribosylation factor-like 9
Gene Name: ARL9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063820: 91%, ENSRNOG00000029628: 83%
Entrez Gene ID: 132946
Uniprot ID: Q6T311
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KQDLEAAYHITDIHEALALSEVGNDRKMFLFGTYLTKNGSEIPSTMQDAKDLIA
Gene Sequence KQDLEAAYHITDIHEALALSEVGNDRKMFLFGTYLTKNGSEIPSTMQDAKDLIA
Gene ID - Mouse ENSMUSG00000063820
Gene ID - Rat ENSRNOG00000029628
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARL9 pAb (ATL-HPA072942 w/enhanced validation)
Datasheet Anti ARL9 pAb (ATL-HPA072942 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARL9 pAb (ATL-HPA072942 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ARL9 pAb (ATL-HPA072942 w/enhanced validation)
Datasheet Anti ARL9 pAb (ATL-HPA072942 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARL9 pAb (ATL-HPA072942 w/enhanced validation)