Anti ARL9 pAb (ATL-HPA072942 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA072942-25

Protein Description: ADP-ribosylation factor-like 9
Gene Name: ARL9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063820: 91%, ENSRNOG00000029628: 83%
Entrez Gene ID: 132946
Uniprot ID: Q6T311
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KQDLEAAYHITDIHEALALSEVGNDRKMFLFGTYLTKNGSEIPSTMQDAKDLIA
• Gene Sequence: KQDLEAAYHITDIHEALALSEVGNDRKMFLFGTYLTKNGSEIPSTMQDAKDLIA
• Gene ID - Mouse: ENSMUSG00000063820
• Gene ID - Rat: ENSRNOG00000029628
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.