Anti ARL8A pAb (ATL-HPA045924)

Atlas Antibodies

Catalog No.:
ATL-HPA045924-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: ADP-ribosylation factor-like 8A
Gene Name: ARL8A
Alternative Gene Name: ARL10B, FLJ45195, Gie2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026426: 100%, ENSRNOG00000005988: 100%
Entrez Gene ID: 127829
Uniprot ID: Q96BM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen ALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS
Gene Sequence ALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS
Gene ID - Mouse ENSMUSG00000026426
Gene ID - Rat ENSRNOG00000005988
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARL8A pAb (ATL-HPA045924)
Datasheet Anti ARL8A pAb (ATL-HPA045924) Datasheet (External Link)
Vendor Page Anti ARL8A pAb (ATL-HPA045924) at Atlas Antibodies

Documents & Links for Anti ARL8A pAb (ATL-HPA045924)
Datasheet Anti ARL8A pAb (ATL-HPA045924) Datasheet (External Link)
Vendor Page Anti ARL8A pAb (ATL-HPA045924)