Anti ARL8A pAb (ATL-HPA040515)

Atlas Antibodies

Catalog No.: ATL-HPA040515-25

Protein Description: ADP-ribosylation factor-like 8A
Gene Name: ARL8A
Alternative Gene Name: ARL10B, FLJ45195, Gie2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026426: 100%, ENSRNOG00000005988: 100%
Entrez Gene ID: 127829
Uniprot ID: Q96BM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRK
• Gene Sequence: GLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRK
• Gene ID - Mouse: ENSMUSG00000026426
• Gene ID - Rat: ENSRNOG00000005988
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.