Anti ARL8A pAb (ATL-HPA040515)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040515-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ARL8A
Alternative Gene Name: ARL10B, FLJ45195, Gie2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026426: 100%, ENSRNOG00000005988: 100%
Entrez Gene ID: 127829
Uniprot ID: Q96BM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRK |
Gene Sequence | GLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRK |
Gene ID - Mouse | ENSMUSG00000026426 |
Gene ID - Rat | ENSRNOG00000005988 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ARL8A pAb (ATL-HPA040515) | |
Datasheet | Anti ARL8A pAb (ATL-HPA040515) Datasheet (External Link) |
Vendor Page | Anti ARL8A pAb (ATL-HPA040515) at Atlas Antibodies |
Documents & Links for Anti ARL8A pAb (ATL-HPA040515) | |
Datasheet | Anti ARL8A pAb (ATL-HPA040515) Datasheet (External Link) |
Vendor Page | Anti ARL8A pAb (ATL-HPA040515) |