Anti ARL6IP6 pAb (ATL-HPA014743 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA014743-25
  • Immunohistochemistry analysis in human placenta and pancreas tissues using Anti-ARL6IP6 antibody. Corresponding ARL6IP6 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear membrane, cytosol & centrosome.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ARL6IP6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407476).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ADP-ribosylation factor-like 6 interacting protein 6
Gene Name: ARL6IP6
Alternative Gene Name: MGC33864
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026960: 72%, ENSRNOG00000005074: 67%
Entrez Gene ID: 151188
Uniprot ID: Q8N6S5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSFAESGWRSALRRRGPGTPGPVARPSYSSFTQGDSWGEGEVDEEEGCDQVARDLRAEFSAGAWSEPRKRSVLPPDGNGSPVLPDKRNGIFP
Gene Sequence MSFAESGWRSALRRRGPGTPGPVARPSYSSFTQGDSWGEGEVDEEEGCDQVARDLRAEFSAGAWSEPRKRSVLPPDGNGSPVLPDKRNGIFP
Gene ID - Mouse ENSMUSG00000026960
Gene ID - Rat ENSRNOG00000005074
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ARL6IP6 pAb (ATL-HPA014743 w/enhanced validation)
Datasheet Anti ARL6IP6 pAb (ATL-HPA014743 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARL6IP6 pAb (ATL-HPA014743 w/enhanced validation)