Anti ARL6IP5 pAb (ATL-HPA015540)

Atlas Antibodies

Catalog No.:
ATL-HPA015540-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ADP-ribosylation factor-like 6 interacting protein 5
Gene Name: ARL6IP5
Alternative Gene Name: DERP11, GTRAP3-18, HSPC127, JWA, PRAF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035199: 85%, ENSRNOG00000006818: 85%
Entrez Gene ID: 10550
Uniprot ID: O75915
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE
Gene Sequence PLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE
Gene ID - Mouse ENSMUSG00000035199
Gene ID - Rat ENSRNOG00000006818
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARL6IP5 pAb (ATL-HPA015540)
Datasheet Anti ARL6IP5 pAb (ATL-HPA015540) Datasheet (External Link)
Vendor Page Anti ARL6IP5 pAb (ATL-HPA015540) at Atlas Antibodies

Documents & Links for Anti ARL6IP5 pAb (ATL-HPA015540)
Datasheet Anti ARL6IP5 pAb (ATL-HPA015540) Datasheet (External Link)
Vendor Page Anti ARL6IP5 pAb (ATL-HPA015540)