Anti ARL6IP5 pAb (ATL-HPA015540)

Atlas Antibodies

Catalog No.: ATL-HPA015540-25

Protein Description: ADP-ribosylation factor-like 6 interacting protein 5
Gene Name: ARL6IP5
Alternative Gene Name: DERP11, GTRAP3-18, HSPC127, JWA, PRAF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035199: 85%, ENSRNOG00000006818: 85%
Entrez Gene ID: 10550
Uniprot ID: O75915
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE
• Gene Sequence: PLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE
• Gene ID - Mouse: ENSMUSG00000035199
• Gene ID - Rat: ENSRNOG00000006818
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.