Anti ARL6IP1 pAb (ATL-HPA045307)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045307-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ARL6IP1
Alternative Gene Name: AIP1, ARL6IP, ARMER, KIAA0069, SPG61
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030654: 98%, ENSRNOG00000017751: 100%
Entrez Gene ID: 23204
Uniprot ID: Q15041
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEE |
| Gene Sequence | FGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEE |
| Gene ID - Mouse | ENSMUSG00000030654 |
| Gene ID - Rat | ENSRNOG00000017751 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARL6IP1 pAb (ATL-HPA045307) | |
| Datasheet | Anti ARL6IP1 pAb (ATL-HPA045307) Datasheet (External Link) |
| Vendor Page | Anti ARL6IP1 pAb (ATL-HPA045307) at Atlas Antibodies |
| Documents & Links for Anti ARL6IP1 pAb (ATL-HPA045307) | |
| Datasheet | Anti ARL6IP1 pAb (ATL-HPA045307) Datasheet (External Link) |
| Vendor Page | Anti ARL6IP1 pAb (ATL-HPA045307) |