Anti ARL5A pAb (ATL-HPA027002)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027002-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ARL5A
Alternative Gene Name: ARL5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036093: 99%, ENSRNOG00000006839: 100%
Entrez Gene ID: 26225
Uniprot ID: Q9Y689
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGL |
| Gene Sequence | QESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGL |
| Gene ID - Mouse | ENSMUSG00000036093 |
| Gene ID - Rat | ENSRNOG00000006839 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARL5A pAb (ATL-HPA027002) | |
| Datasheet | Anti ARL5A pAb (ATL-HPA027002) Datasheet (External Link) |
| Vendor Page | Anti ARL5A pAb (ATL-HPA027002) at Atlas Antibodies |
| Documents & Links for Anti ARL5A pAb (ATL-HPA027002) | |
| Datasheet | Anti ARL5A pAb (ATL-HPA027002) Datasheet (External Link) |
| Vendor Page | Anti ARL5A pAb (ATL-HPA027002) |