Anti ARL4D pAb (ATL-HPA060379)

Atlas Antibodies

Catalog No.:
ATL-HPA060379-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ADP-ribosylation factor-like 4D
Gene Name: ARL4D
Alternative Gene Name: ARF4L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034936: 100%, ENSRNOG00000020770: 100%
Entrez Gene ID: 379
Uniprot ID: P49703
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKT
Gene Sequence MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKT
Gene ID - Mouse ENSMUSG00000034936
Gene ID - Rat ENSRNOG00000020770
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARL4D pAb (ATL-HPA060379)
Datasheet Anti ARL4D pAb (ATL-HPA060379) Datasheet (External Link)
Vendor Page Anti ARL4D pAb (ATL-HPA060379) at Atlas Antibodies

Documents & Links for Anti ARL4D pAb (ATL-HPA060379)
Datasheet Anti ARL4D pAb (ATL-HPA060379) Datasheet (External Link)
Vendor Page Anti ARL4D pAb (ATL-HPA060379)