Anti ARL4A pAb (ATL-HPA064513)

Atlas Antibodies

Catalog No.:
ATL-HPA064513-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ADP-ribosylation factor-like 4A
Gene Name: ARL4A
Alternative Gene Name: ARL4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047446: 97%, ENSRNOG00000004282: 97%
Entrez Gene ID: 10124
Uniprot ID: P40617
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGNGLSDQTSILSNLPSFQSFHIVILGLDC
Gene Sequence MGNGLSDQTSILSNLPSFQSFHIVILGLDC
Gene ID - Mouse ENSMUSG00000047446
Gene ID - Rat ENSRNOG00000004282
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARL4A pAb (ATL-HPA064513)
Datasheet Anti ARL4A pAb (ATL-HPA064513) Datasheet (External Link)
Vendor Page Anti ARL4A pAb (ATL-HPA064513) at Atlas Antibodies

Documents & Links for Anti ARL4A pAb (ATL-HPA064513)
Datasheet Anti ARL4A pAb (ATL-HPA064513) Datasheet (External Link)
Vendor Page Anti ARL4A pAb (ATL-HPA064513)