Anti ARL4A pAb (ATL-HPA064513)
Atlas Antibodies
- SKU:
- ATL-HPA064513-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ARL4A
Alternative Gene Name: ARL4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047446: 97%, ENSRNOG00000004282: 97%
Entrez Gene ID: 10124
Uniprot ID: P40617
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MGNGLSDQTSILSNLPSFQSFHIVILGLDC |
Gene Sequence | MGNGLSDQTSILSNLPSFQSFHIVILGLDC |
Gene ID - Mouse | ENSMUSG00000047446 |
Gene ID - Rat | ENSRNOG00000004282 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ARL4A pAb (ATL-HPA064513) | |
Datasheet | Anti ARL4A pAb (ATL-HPA064513) Datasheet (External Link) |
Vendor Page | Anti ARL4A pAb (ATL-HPA064513) at Atlas Antibodies |
Documents & Links for Anti ARL4A pAb (ATL-HPA064513) | |
Datasheet | Anti ARL4A pAb (ATL-HPA064513) Datasheet (External Link) |
Vendor Page | Anti ARL4A pAb (ATL-HPA064513) |