Anti ARL3 pAb (ATL-HPA063596)

Atlas Antibodies

Catalog No.:
ATL-HPA063596-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ADP-ribosylation factor-like 3
Gene Name: ARL3
Alternative Gene Name: ARFL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025035: 100%, ENSRNOG00000019973: 97%
Entrez Gene ID: 403
Uniprot ID: P36405
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALT
Gene Sequence FANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALT
Gene ID - Mouse ENSMUSG00000025035
Gene ID - Rat ENSRNOG00000019973
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARL3 pAb (ATL-HPA063596)
Datasheet Anti ARL3 pAb (ATL-HPA063596) Datasheet (External Link)
Vendor Page Anti ARL3 pAb (ATL-HPA063596) at Atlas Antibodies

Documents & Links for Anti ARL3 pAb (ATL-HPA063596)
Datasheet Anti ARL3 pAb (ATL-HPA063596) Datasheet (External Link)
Vendor Page Anti ARL3 pAb (ATL-HPA063596)