Anti ARL3 pAb (ATL-HPA036292)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036292-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ARL3
Alternative Gene Name: ARFL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025035: 95%, ENSRNOG00000019973: 94%
Entrez Gene ID: 403
Uniprot ID: P36405
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLI |
| Gene Sequence | KLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLI |
| Gene ID - Mouse | ENSMUSG00000025035 |
| Gene ID - Rat | ENSRNOG00000019973 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARL3 pAb (ATL-HPA036292) | |
| Datasheet | Anti ARL3 pAb (ATL-HPA036292) Datasheet (External Link) |
| Vendor Page | Anti ARL3 pAb (ATL-HPA036292) at Atlas Antibodies |
| Documents & Links for Anti ARL3 pAb (ATL-HPA036292) | |
| Datasheet | Anti ARL3 pAb (ATL-HPA036292) Datasheet (External Link) |
| Vendor Page | Anti ARL3 pAb (ATL-HPA036292) |