Anti ARL3 pAb (ATL-HPA036292)

Atlas Antibodies

Catalog No.: ATL-HPA036292-25

Protein Description: ADP-ribosylation factor-like 3
Gene Name: ARL3
Alternative Gene Name: ARFL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025035: 95%, ENSRNOG00000019973: 94%
Entrez Gene ID: 403
Uniprot ID: P36405
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLI
• Gene Sequence: KLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLI
• Gene ID - Mouse: ENSMUSG00000025035
• Gene ID - Rat: ENSRNOG00000019973
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.