Anti ARL2BP pAb (ATL-HPA043066)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043066-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ARL2BP
Alternative Gene Name: BART, BART1, RP66
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031776: 94%, ENSRNOG00000016991: 92%
Entrez Gene ID: 23568
Uniprot ID: Q9Y2Y0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRI |
Gene Sequence | MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRI |
Gene ID - Mouse | ENSMUSG00000031776 |
Gene ID - Rat | ENSRNOG00000016991 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ARL2BP pAb (ATL-HPA043066) | |
Datasheet | Anti ARL2BP pAb (ATL-HPA043066) Datasheet (External Link) |
Vendor Page | Anti ARL2BP pAb (ATL-HPA043066) at Atlas Antibodies |
Documents & Links for Anti ARL2BP pAb (ATL-HPA043066) | |
Datasheet | Anti ARL2BP pAb (ATL-HPA043066) Datasheet (External Link) |
Vendor Page | Anti ARL2BP pAb (ATL-HPA043066) |