Anti ARL2 pAb (ATL-HPA044610)

Atlas Antibodies

Catalog No.: ATL-HPA044610-25

Protein Description: ADP-ribosylation factor-like 2
Gene Name: ARL2
Alternative Gene Name: ARFL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024944: 89%, ENSRNOG00000021010: 89%
Entrez Gene ID: 402
Uniprot ID: P36404
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTA
• Gene Sequence: DLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTA
• Gene ID - Mouse: ENSMUSG00000024944
• Gene ID - Rat: ENSRNOG00000021010
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ARL2 pAb (ATL-HPA044610) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.