Anti ARL2 pAb (ATL-HPA044610)

Atlas Antibodies

Catalog No.:
ATL-HPA044610-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ADP-ribosylation factor-like 2
Gene Name: ARL2
Alternative Gene Name: ARFL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024944: 89%, ENSRNOG00000021010: 89%
Entrez Gene ID: 402
Uniprot ID: P36404
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTA
Gene Sequence DLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTA
Gene ID - Mouse ENSMUSG00000024944
Gene ID - Rat ENSRNOG00000021010
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARL2 pAb (ATL-HPA044610)
Datasheet Anti ARL2 pAb (ATL-HPA044610) Datasheet (External Link)
Vendor Page Anti ARL2 pAb (ATL-HPA044610) at Atlas Antibodies

Documents & Links for Anti ARL2 pAb (ATL-HPA044610)
Datasheet Anti ARL2 pAb (ATL-HPA044610) Datasheet (External Link)
Vendor Page Anti ARL2 pAb (ATL-HPA044610)
Citations for Anti ARL2 pAb (ATL-HPA044610) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed