Anti ARL17A pAb (ATL-HPA046814)

Atlas Antibodies

Catalog No.: ATL-HPA046814-25

Protein Description: ADP-ribosylation factor-like 17A
Gene Name: ARL17A
Alternative Gene Name: ARF1P2, ARL17P1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070331: 27%, ENSRNOG00000021867: 29%
Entrez Gene ID: 51326
Uniprot ID: Q8IVW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IRPLWQHFFQNTKGARSPGSTHQGSLASGVLPIKCSHVEFGMWKGGRSH
• Gene Sequence: IRPLWQHFFQNTKGARSPGSTHQGSLASGVLPIKCSHVEFGMWKGGRSH
• Gene ID - Mouse: ENSMUSG00000070331
• Gene ID - Rat: ENSRNOG00000021867
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.