Anti ARL17A pAb (ATL-HPA046814)

Atlas Antibodies

Catalog No.:
ATL-HPA046814-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ADP-ribosylation factor-like 17A
Gene Name: ARL17A
Alternative Gene Name: ARF1P2, ARL17P1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070331: 27%, ENSRNOG00000021867: 29%
Entrez Gene ID: 51326
Uniprot ID: Q8IVW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IRPLWQHFFQNTKGARSPGSTHQGSLASGVLPIKCSHVEFGMWKGGRSH
Gene Sequence IRPLWQHFFQNTKGARSPGSTHQGSLASGVLPIKCSHVEFGMWKGGRSH
Gene ID - Mouse ENSMUSG00000070331
Gene ID - Rat ENSRNOG00000021867
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARL17A pAb (ATL-HPA046814)
Datasheet Anti ARL17A pAb (ATL-HPA046814) Datasheet (External Link)
Vendor Page Anti ARL17A pAb (ATL-HPA046814) at Atlas Antibodies

Documents & Links for Anti ARL17A pAb (ATL-HPA046814)
Datasheet Anti ARL17A pAb (ATL-HPA046814) Datasheet (External Link)
Vendor Page Anti ARL17A pAb (ATL-HPA046814)