Anti ARL17A pAb (ATL-HPA046814)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046814-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ARL17A
Alternative Gene Name: ARF1P2, ARL17P1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070331: 27%, ENSRNOG00000021867: 29%
Entrez Gene ID: 51326
Uniprot ID: Q8IVW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IRPLWQHFFQNTKGARSPGSTHQGSLASGVLPIKCSHVEFGMWKGGRSH |
| Gene Sequence | IRPLWQHFFQNTKGARSPGSTHQGSLASGVLPIKCSHVEFGMWKGGRSH |
| Gene ID - Mouse | ENSMUSG00000070331 |
| Gene ID - Rat | ENSRNOG00000021867 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARL17A pAb (ATL-HPA046814) | |
| Datasheet | Anti ARL17A pAb (ATL-HPA046814) Datasheet (External Link) |
| Vendor Page | Anti ARL17A pAb (ATL-HPA046814) at Atlas Antibodies |
| Documents & Links for Anti ARL17A pAb (ATL-HPA046814) | |
| Datasheet | Anti ARL17A pAb (ATL-HPA046814) Datasheet (External Link) |
| Vendor Page | Anti ARL17A pAb (ATL-HPA046814) |