Anti ARL16 pAb (ATL-HPA043711)

Atlas Antibodies

Catalog No.:
ATL-HPA043711-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ADP-ribosylation factor-like 16
Gene Name: ARL16
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057594: 80%, ENSRNOG00000049235: 79%
Entrez Gene ID: 339231
Uniprot ID: Q0P5N6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TQLSASCVQLLGLLSAEQLAEASVLILFNKIDLPCYMSTEEMKSLIRLPDIIACAKQNITTAEISAREGTGLAGVLAWLQATHRAND
Gene Sequence TQLSASCVQLLGLLSAEQLAEASVLILFNKIDLPCYMSTEEMKSLIRLPDIIACAKQNITTAEISAREGTGLAGVLAWLQATHRAND
Gene ID - Mouse ENSMUSG00000057594
Gene ID - Rat ENSRNOG00000049235
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARL16 pAb (ATL-HPA043711)
Datasheet Anti ARL16 pAb (ATL-HPA043711) Datasheet (External Link)
Vendor Page Anti ARL16 pAb (ATL-HPA043711) at Atlas Antibodies

Documents & Links for Anti ARL16 pAb (ATL-HPA043711)
Datasheet Anti ARL16 pAb (ATL-HPA043711) Datasheet (External Link)
Vendor Page Anti ARL16 pAb (ATL-HPA043711)
Citations for Anti ARL16 pAb (ATL-HPA043711) – 1 Found
Dewees, Skylar I; Vargová, Romana; Hardin, Katherine R; Turn, Rachel E; Devi, Saroja; Linnert, Joshua; Wolfrum, Uwe; Caspary, Tamara; Eliáš, Marek; Kahn, Richard A. Phylogenetic profiling and cellular analyses of ARL16 reveal roles in traffic of IFT140 and INPP5E. Molecular Biology Of The Cell. 2022;33(4):ar33.  PubMed