Anti ARL16 pAb (ATL-HPA043711)
Atlas Antibodies
- SKU:
- ATL-HPA043711-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ARL16
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057594: 80%, ENSRNOG00000049235: 79%
Entrez Gene ID: 339231
Uniprot ID: Q0P5N6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TQLSASCVQLLGLLSAEQLAEASVLILFNKIDLPCYMSTEEMKSLIRLPDIIACAKQNITTAEISAREGTGLAGVLAWLQATHRAND |
| Gene Sequence | TQLSASCVQLLGLLSAEQLAEASVLILFNKIDLPCYMSTEEMKSLIRLPDIIACAKQNITTAEISAREGTGLAGVLAWLQATHRAND |
| Gene ID - Mouse | ENSMUSG00000057594 |
| Gene ID - Rat | ENSRNOG00000049235 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARL16 pAb (ATL-HPA043711) | |
| Datasheet | Anti ARL16 pAb (ATL-HPA043711) Datasheet (External Link) |
| Vendor Page | Anti ARL16 pAb (ATL-HPA043711) at Atlas Antibodies |
| Documents & Links for Anti ARL16 pAb (ATL-HPA043711) | |
| Datasheet | Anti ARL16 pAb (ATL-HPA043711) Datasheet (External Link) |
| Vendor Page | Anti ARL16 pAb (ATL-HPA043711) |
| Citations for Anti ARL16 pAb (ATL-HPA043711) – 1 Found |
| Dewees, Skylar I; Vargová, Romana; Hardin, Katherine R; Turn, Rachel E; Devi, Saroja; Linnert, Joshua; Wolfrum, Uwe; Caspary, Tamara; Eliáš, Marek; Kahn, Richard A. Phylogenetic profiling and cellular analyses of ARL16 reveal roles in traffic of IFT140 and INPP5E. Molecular Biology Of The Cell. 2022;33(4):ar33. PubMed |