Anti ARL15 pAb (ATL-HPA063820)

Atlas Antibodies

Catalog No.:
ATL-HPA063820-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ADP-ribosylation factor-like 15
Gene Name: ARL15
Alternative Gene Name: ARFRP2, FLJ20051
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042348: 98%, ENSRNOG00000011105: 98%
Entrez Gene ID: 54622
Uniprot ID: Q9NXU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEKDHEAVRM
Gene Sequence LHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEKDHEAVRM
Gene ID - Mouse ENSMUSG00000042348
Gene ID - Rat ENSRNOG00000011105
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARL15 pAb (ATL-HPA063820)
Datasheet Anti ARL15 pAb (ATL-HPA063820) Datasheet (External Link)
Vendor Page Anti ARL15 pAb (ATL-HPA063820) at Atlas Antibodies

Documents & Links for Anti ARL15 pAb (ATL-HPA063820)
Datasheet Anti ARL15 pAb (ATL-HPA063820) Datasheet (External Link)
Vendor Page Anti ARL15 pAb (ATL-HPA063820)
Citations for Anti ARL15 pAb (ATL-HPA063820) – 1 Found
Wu, Yixing; Bai, Ying; McEwan, David G; Bentley, Liz; Aravani, Dimitra; Cox, Roger D. Palmitoylated small GTPase ARL15 is translocated within Golgi network during adipogenesis. Biology Open. 2021;10(12)  PubMed