Anti ARL14EP pAb (ATL-HPA039634)

Atlas Antibodies

SKU:
ATL-HPA039634-25
  • Immunohistochemical staining of human rectum shows strong cytoplasmic, membranous and nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol, focal adhesion sites & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ADP-ribosylation factor-like 14 effector protein
Gene Name: ARL14EP
Alternative Gene Name: ARF7EP, C11orf46, FLJ38968
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027122: 88%, ENSRNOG00000004891: 91%
Entrez Gene ID: 120534
Uniprot ID: Q8N8R7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SAKFGRQLVPGWKLCPKCTQIINGSVDVDTEDRQKRKPESDGRTAKALRSLQFTNPGRQTEFAPETGKREKRRLTKNATAGSDRQVIPAKSKVYDSQGLL
Gene Sequence SAKFGRQLVPGWKLCPKCTQIINGSVDVDTEDRQKRKPESDGRTAKALRSLQFTNPGRQTEFAPETGKREKRRLTKNATAGSDRQVIPAKSKVYDSQGLL
Gene ID - Mouse ENSMUSG00000027122
Gene ID - Rat ENSRNOG00000004891
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARL14EP pAb (ATL-HPA039634)
Datasheet Anti ARL14EP pAb (ATL-HPA039634) Datasheet (External Link)
Vendor Page Anti ARL14EP pAb (ATL-HPA039634) at Atlas Antibodies

Documents & Links for Anti ARL14EP pAb (ATL-HPA039634)
Datasheet Anti ARL14EP pAb (ATL-HPA039634) Datasheet (External Link)
Vendor Page Anti ARL14EP pAb (ATL-HPA039634)