Anti ARL13A pAb (ATL-HPA037378)

Atlas Antibodies

Catalog No.:
ATL-HPA037378-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ADP-ribosylation factor-like 13A
Gene Name: ARL13A
Alternative Gene Name: ARL13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052549: 66%, ENSRNOG00000055454: 67%
Entrez Gene ID: 392509
Uniprot ID: Q5H913
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EETRRNVTIPIIGLNNSGKTVLVEAFQKLLPSKTDHCMKSELTTLLLDEYELSIYDLNGDLKGREAWPNYYAQAHGLVFVLDS
Gene Sequence EETRRNVTIPIIGLNNSGKTVLVEAFQKLLPSKTDHCMKSELTTLLLDEYELSIYDLNGDLKGREAWPNYYAQAHGLVFVLDS
Gene ID - Mouse ENSMUSG00000052549
Gene ID - Rat ENSRNOG00000055454
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARL13A pAb (ATL-HPA037378)
Datasheet Anti ARL13A pAb (ATL-HPA037378) Datasheet (External Link)
Vendor Page Anti ARL13A pAb (ATL-HPA037378) at Atlas Antibodies

Documents & Links for Anti ARL13A pAb (ATL-HPA037378)
Datasheet Anti ARL13A pAb (ATL-HPA037378) Datasheet (External Link)
Vendor Page Anti ARL13A pAb (ATL-HPA037378)