Anti ARL11 pAb (ATL-HPA040887 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA040887-25
  • Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in seminiferus ducts and Leydig cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ARL11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408600).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ADP-ribosylation factor-like 11
Gene Name: ARL11
Alternative Gene Name: ARLTS1, FLJ33930
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043157: 82%, ENSRNOG00000014653: 82%
Entrez Gene ID: 115761
Uniprot ID: Q969Q4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLWDVGGQAPLRASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGV
Gene Sequence TLWDVGGQAPLRASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGV
Gene ID - Mouse ENSMUSG00000043157
Gene ID - Rat ENSRNOG00000014653
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARL11 pAb (ATL-HPA040887 w/enhanced validation)
Datasheet Anti ARL11 pAb (ATL-HPA040887 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARL11 pAb (ATL-HPA040887 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ARL11 pAb (ATL-HPA040887 w/enhanced validation)
Datasheet Anti ARL11 pAb (ATL-HPA040887 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARL11 pAb (ATL-HPA040887 w/enhanced validation)