Anti ARL1 pAb (ATL-HPA073012)

Atlas Antibodies

Catalog No.:
ATL-HPA073012-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ADP-ribosylation factor-like 1
Gene Name: ARL1
Alternative Gene Name: ARFL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060904: 100%, ENSRNOG00000005763: 100%
Entrez Gene ID: 400
Uniprot ID: P40616
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ
Gene Sequence ALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ
Gene ID - Mouse ENSMUSG00000060904
Gene ID - Rat ENSRNOG00000005763
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARL1 pAb (ATL-HPA073012)
Datasheet Anti ARL1 pAb (ATL-HPA073012) Datasheet (External Link)
Vendor Page Anti ARL1 pAb (ATL-HPA073012) at Atlas Antibodies

Documents & Links for Anti ARL1 pAb (ATL-HPA073012)
Datasheet Anti ARL1 pAb (ATL-HPA073012) Datasheet (External Link)
Vendor Page Anti ARL1 pAb (ATL-HPA073012)