Anti ARIH2 pAb (ATL-HPA067381)

Atlas Antibodies

Catalog No.:
ATL-HPA067381-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ariadne RBR E3 ubiquitin protein ligase 2
Gene Name: ARIH2
Alternative Gene Name: TRIAD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064145: 99%, ENSRNOG00000031827: 100%
Entrez Gene ID: 10425
Uniprot ID: O95376
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YFERWENHNKSLQLEAQTYQRIHEKIQERVMNNLGTWIDWQYLQNAAKLLAKCRYTLQYTYPYAYYMESGPRKKLFEYQQAQLEAEIENLSWKVERADSYDRGDLENQMHIAEQRRRTLLKD
Gene Sequence YFERWENHNKSLQLEAQTYQRIHEKIQERVMNNLGTWIDWQYLQNAAKLLAKCRYTLQYTYPYAYYMESGPRKKLFEYQQAQLEAEIENLSWKVERADSYDRGDLENQMHIAEQRRRTLLKD
Gene ID - Mouse ENSMUSG00000064145
Gene ID - Rat ENSRNOG00000031827
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARIH2 pAb (ATL-HPA067381)
Datasheet Anti ARIH2 pAb (ATL-HPA067381) Datasheet (External Link)
Vendor Page Anti ARIH2 pAb (ATL-HPA067381) at Atlas Antibodies

Documents & Links for Anti ARIH2 pAb (ATL-HPA067381)
Datasheet Anti ARIH2 pAb (ATL-HPA067381) Datasheet (External Link)
Vendor Page Anti ARIH2 pAb (ATL-HPA067381)