Anti ARIH2 pAb (ATL-HPA067381)

Atlas Antibodies

Catalog No.: ATL-HPA067381-25

Protein Description: ariadne RBR E3 ubiquitin protein ligase 2
Gene Name: ARIH2
Alternative Gene Name: TRIAD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064145: 99%, ENSRNOG00000031827: 100%
Entrez Gene ID: 10425
Uniprot ID: O95376
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YFERWENHNKSLQLEAQTYQRIHEKIQERVMNNLGTWIDWQYLQNAAKLLAKCRYTLQYTYPYAYYMESGPRKKLFEYQQAQLEAEIENLSWKVERADSYDRGDLENQMHIAEQRRRTLLKD
• Gene Sequence: YFERWENHNKSLQLEAQTYQRIHEKIQERVMNNLGTWIDWQYLQNAAKLLAKCRYTLQYTYPYAYYMESGPRKKLFEYQQAQLEAEIENLSWKVERADSYDRGDLENQMHIAEQRRRTLLKD
• Gene ID - Mouse: ENSMUSG00000064145
• Gene ID - Rat: ENSRNOG00000031827
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.