Anti ARIH1 pAb (ATL-HPA073245)

Atlas Antibodies

Catalog No.:
ATL-HPA073245-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ariadne RBR E3 ubiquitin protein ligase 1
Gene Name: ARIH1
Alternative Gene Name: ARI, HARI, HHARI, UBCH7BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025234: 100%, ENSRNOG00000009887: 100%
Entrez Gene ID: 25820
Uniprot ID: Q9Y4X5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNEDDAKAARDAQERSRAALQRYLFYCNRYMNHMQSLRFEHKLYAQVKQKMEEMQQHN
Gene Sequence NHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNEDDAKAARDAQERSRAALQRYLFYCNRYMNHMQSLRFEHKLYAQVKQKMEEMQQHN
Gene ID - Mouse ENSMUSG00000025234
Gene ID - Rat ENSRNOG00000009887
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARIH1 pAb (ATL-HPA073245)
Datasheet Anti ARIH1 pAb (ATL-HPA073245) Datasheet (External Link)
Vendor Page Anti ARIH1 pAb (ATL-HPA073245) at Atlas Antibodies

Documents & Links for Anti ARIH1 pAb (ATL-HPA073245)
Datasheet Anti ARIH1 pAb (ATL-HPA073245) Datasheet (External Link)
Vendor Page Anti ARIH1 pAb (ATL-HPA073245)