Anti ARIH1 pAb (ATL-HPA073245)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073245-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ARIH1
Alternative Gene Name: ARI, HARI, HHARI, UBCH7BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025234: 100%, ENSRNOG00000009887: 100%
Entrez Gene ID: 25820
Uniprot ID: Q9Y4X5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNEDDAKAARDAQERSRAALQRYLFYCNRYMNHMQSLRFEHKLYAQVKQKMEEMQQHN |
Gene Sequence | NHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNEDDAKAARDAQERSRAALQRYLFYCNRYMNHMQSLRFEHKLYAQVKQKMEEMQQHN |
Gene ID - Mouse | ENSMUSG00000025234 |
Gene ID - Rat | ENSRNOG00000009887 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ARIH1 pAb (ATL-HPA073245) | |
Datasheet | Anti ARIH1 pAb (ATL-HPA073245) Datasheet (External Link) |
Vendor Page | Anti ARIH1 pAb (ATL-HPA073245) at Atlas Antibodies |
Documents & Links for Anti ARIH1 pAb (ATL-HPA073245) | |
Datasheet | Anti ARIH1 pAb (ATL-HPA073245) Datasheet (External Link) |
Vendor Page | Anti ARIH1 pAb (ATL-HPA073245) |