Anti ARID5B pAb (ATL-HPA015037)
Atlas Antibodies
- Catalog No.:
- ATL-HPA015037-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ARID5B
Alternative Gene Name: FLJ21150, MRF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019947: 82%, ENSRNOG00000012563: 24%
Entrez Gene ID: 84159
Uniprot ID: Q14865
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TSKYPSRDMYRESENSSFPSHRHQEKLHVNYLTSLHLQDKKSAAAEAPTDDQPTDLSLPKNPHKPTGKVLGLAHSTTGPQESKGISQFQVLGSQSRDCHPKACRVSPMTMSGPKKYPESLSRSGKPHHVRLENFRKME |
| Gene Sequence | TSKYPSRDMYRESENSSFPSHRHQEKLHVNYLTSLHLQDKKSAAAEAPTDDQPTDLSLPKNPHKPTGKVLGLAHSTTGPQESKGISQFQVLGSQSRDCHPKACRVSPMTMSGPKKYPESLSRSGKPHHVRLENFRKME |
| Gene ID - Mouse | ENSMUSG00000019947 |
| Gene ID - Rat | ENSRNOG00000012563 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARID5B pAb (ATL-HPA015037) | |
| Datasheet | Anti ARID5B pAb (ATL-HPA015037) Datasheet (External Link) |
| Vendor Page | Anti ARID5B pAb (ATL-HPA015037) at Atlas Antibodies |
| Documents & Links for Anti ARID5B pAb (ATL-HPA015037) | |
| Datasheet | Anti ARID5B pAb (ATL-HPA015037) Datasheet (External Link) |
| Vendor Page | Anti ARID5B pAb (ATL-HPA015037) |
| Citations for Anti ARID5B pAb (ATL-HPA015037) – 4 Found |
| Singh, Balraj; Kinne, Hannah E; Milligan, Ryan D; Washburn, Laura J; Olsen, Mark; Lucci, Anthony. Important Role of FTO in the Survival of Rare Panresistant Triple-Negative Inflammatory Breast Cancer Cells Facing a Severe Metabolic Challenge. Plos One. 11(7):e0159072. PubMed |
| Leong, Wei Zhong; Tan, Shi Hao; Ngoc, Phuong Cao Thi; Amanda, Stella; Yam, Alice Wei Yee; Liau, Wei-Siang; Gong, Zhiyuan; Lawton, Lee N; Tenen, Daniel G; Sanda, Takaomi. ARID5B as a critical downstream target of the TAL1 complex that activates the oncogenic transcriptional program and promotes T-cell leukemogenesis. Genes & Development. 2017;31(23-24):2343-2360. PubMed |
| Xu, Heng; Zhao, Xujie; Bhojwani, Deepa; E, Shuyu; Goodings, Charnise; Zhang, Hui; Seibel, Nita L; Yang, Wentao; Li, Chunliang; Carroll, William L; Evans, William E; Yang, Jun J. ARID5B Influences Antimetabolite Drug Sensitivity and Prognosis of Acute Lymphoblastic Leukemia. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2020;26(1):256-264. PubMed |
| Yamato, Azusa; Nagano, Hidekazu; Gao, Yue; Matsuda, Tatsuma; Hashimoto, Naoko; Nakayama, Akitoshi; Yamagata, Kazuyuki; Yokoyama, Masataka; Gong, Yingbo; Shi, Xiaoyan; Zhahara, Siti Nurul; Kono, Takashi; Taki, Yuki; Furuki, Naoto; Nishimura, Motoi; Horiguchi, Kentaro; Iwadate, Yasuo; Fukuyo, Masaki; Rahmutulla, Bahityar; Kaneda, Atsushi; Hasegawa, Yoshinori; Kawashima, Yusuke; Ohara, Osamu; Ishikawa, Tetsuo; Kawakami, Eiryo; Nakamura, Yasuhiro; Inoshita, Naoko; Yamada, Shozo; Fukuhara, Noriaki; Nishioka, Hiroshi; Tanaka, Tomoaki. Proteogenomic landscape and clinical characterization of GH-producing pituitary adenomas/somatotroph pituitary neuroendocrine tumors. Communications Biology. 2022;5(1):1304. PubMed |