Anti ARID5A pAb (ATL-HPA023879)

Atlas Antibodies

SKU:
ATL-HPA023879-25
  • Immunohistochemical staining of human urinary bladder shows strong nuclear positivity in urothelial cells.
  • Immunofluorescent staining of human cell line A-431 shows positivity in nucleus & nucleoli.
  • Western blot analysis in human cell line HDLM-2.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: AT rich interactive domain 5A (MRF1-like)
Gene Name: ARID5A
Alternative Gene Name: MRF-1, RP11-363D14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037447: 72%, ENSRNOG00000015382: 71%
Entrez Gene ID: 10865
Uniprot ID: Q03989
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVLPYVRHLKGEDDKPLPTSKPRKQYKMAKENRGDDGATERPKKAKEERRMDQMMPGKTKADAADPAPLPSQEPPRNSTEQQGLASGSSVSFVGASGCPEAYKRLLSSFYCKGTH
Gene Sequence LVLPYVRHLKGEDDKPLPTSKPRKQYKMAKENRGDDGATERPKKAKEERRMDQMMPGKTKADAADPAPLPSQEPPRNSTEQQGLASGSSVSFVGASGCPEAYKRLLSSFYCKGTH
Gene ID - Mouse ENSMUSG00000037447
Gene ID - Rat ENSRNOG00000015382
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARID5A pAb (ATL-HPA023879)
Datasheet Anti ARID5A pAb (ATL-HPA023879) Datasheet (External Link)
Vendor Page Anti ARID5A pAb (ATL-HPA023879) at Atlas Antibodies

Documents & Links for Anti ARID5A pAb (ATL-HPA023879)
Datasheet Anti ARID5A pAb (ATL-HPA023879) Datasheet (External Link)
Vendor Page Anti ARID5A pAb (ATL-HPA023879)