Anti ARID4B pAb (ATL-HPA027333)

Atlas Antibodies

SKU: ATL-HPA027333-25

• 

Protein Description: AT rich interactive domain 4B (RBP1-like)
Gene Name: ARID4B
Alternative Gene Name: BCAA, BRCAA1, RBP1L1, SAP180
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039219: 78%, ENSRNOG00000016391: 71%
Entrez Gene ID: 51742
Uniprot ID: Q4LE39
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DNNGKEESKIDHLTNNRNDLISKEEQNSSSLLEENKVHADLVISKPVSKSPERLRKDIEVLSEDTDYEEDEVTKKRKDVKKDTTDKSSKPQIKRGKR
• Gene Sequence: DNNGKEESKIDHLTNNRNDLISKEEQNSSSLLEENKVHADLVISKPVSKSPERLRKDIEVLSEDTDYEEDEVTKKRKDVKKDTTDKSSKPQIKRGKR
• Gene ID - Mouse: ENSMUSG00000039219
• Gene ID - Rat: ENSRNOG00000016391
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ARID4B pAb (ATL-HPA027333) – 1 Found

Luo, Siou-Min; Tsai, Wen-Chiuan; Tsai, Chia-Kuang; Chen, Ying; Hueng, Dueng-Yuan. ARID4B Knockdown Suppresses PI3K/AKT Signaling and Induces Apoptosis in Human Glioma Cells. Oncotargets And Therapy. 14( 33732001):1843-1855.